PDB entry 2e30

View 2e30 on RCSB PDB site
Description: Solution structure of the cytoplasmic region of Na+/H+ exchanger 1 complexed with essential cofactor calcineurin B homologous protein 1
Class: metal binding protein/transport protein
Keywords: NMR, transporter, EF-hand, complex structure, METAL BINDING PROTEIN/TRANSPORT PROTEIN COMPLEX
Deposited on 2006-11-19, released 2006-12-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2008-06-17, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcium-binding protein p22
    Species: Homo sapiens [TaxId:9606]
    Gene: CHP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2e30a_
  • Chain 'B':
    Compound: sodium/hydrogen exchanger 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2e30A (A:)
mgsrastllrdeeleeikketgfshsqitrlysrftsldkgengtlsredfqripelain
plgdriinaffpegedqvnfrgfmrtlahfrpiednekskdvngpeplnsrsnklhfafr
lydldkdekisrdellqvlrmmvgvnisdeqlgsiadrtiqeadqdgdsaisftefvkvl
ekvdveqkmsirflh

  • Chain 'B':
    No sequence available.