PDB entry 2e2c

View 2e2c on RCSB PDB site
Description: e2-c, an ubiquitin conjugating enzyme required for the destruction of mitotic cyclins
Deposited on 1999-01-19, released 1999-01-27
The last revision prior to the SCOP 1.55 freeze date was dated 1999-04-06, with a file datestamp of 1999-04-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d2e2c__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2e2c_ (-)
mttskerhsvskrlqqelrtllmsgdpgitafpdgdnlfkwvatldgpkdtvyeslkykl
tlefpsdypykppvvkfttpcwhpnvdqsgnicldilkenwtasydvrtillslqsllge
pnnasplnaqaadmwsnqteykkvlhekyktaqsdk