PDB entry 2e2b

View 2e2b on RCSB PDB site
Description: Crystal structure of the c-Abl kinase domain in complex with INNO-406
Class: transferase
Keywords: c-Abl, kinase, INNO-406, TRANSFERASE
Deposited on 2006-11-10, released 2007-05-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.236
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00519 (6-End)
      • cloning artifact (2-5)
    Domains in SCOPe 2.06: d2e2ba1, d2e2ba2
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase ABL1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00519 (6-End)
      • cloning artifact (2-5)
    Domains in SCOPe 2.06: d2e2bb1, d2e2bb2
  • Heterogens: 406, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e2bA (A:)
    gamdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmevee
    flkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvlly
    matqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfp
    ikwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpe
    gcpekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgkqgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e2bA (A:)
    mdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlmeveeflkeaa
    vmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqis
    sameylekknfihrdlaarnclvgenhlvkvadfglsrltytahagakfpikwtapesla
    ynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelm
    racwqwnpsdrpsfaeihqafetmfqessi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2e2bB (B:)
    gamdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmevee
    flkeaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvlly
    matqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfp
    ikwtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpe
    gcpekvyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgkqgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e2bB (B:)
    mdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktleveeflkeaav
    mkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqiss
    ameylekknfihrdlaarnclvgenhlvkvadfglstytahagakfpikwtapeslaynk
    fsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmrac
    wqwnpsdrpsfaeihqafetmf