PDB entry 2e1h

View 2e1h on RCSB PDB site
Description: Crystal Structure Of Biotin Protein Ligase From Pyrococcus Horikoshii OT3, K111G mutation
Class: ligase
Keywords: Biotin Biosynthesis, Dimer, X-ray Diffraction, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIGASE
Deposited on 2006-10-25, released 2007-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.214
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 235aa long hypothetical biotin-[acetyl-CoA-carboxylase] ligase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: birA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57883 (0-234)
      • engineered (110)
    Domains in SCOPe 2.07: d2e1ha1, d2e1ha2
  • Chain 'B':
    Compound: 235aa long hypothetical biotin-[acetyl-CoA-carboxylase] ligase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: birA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57883 (0-234)
      • engineered (110)
    Domains in SCOPe 2.07: d2e1hb1, d2e1hb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e1hA (A:)
    mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
    wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykgiagvlvegk
    gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
    lvrdnmilgvrvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e1hA (A:)
    mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghespegglwlsivls
    pkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykgiagvlvegkivlgigl
    nvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdilnlvrdnmilgv
    rvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2e1hB (B:)
    mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
    wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykgiagvlvegk
    gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
    lvrdnmilgvrvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl