PDB entry 2e1f

View 2e1f on RCSB PDB site
Description: Crystal structure of the HRDC Domain of Human Werner Syndrome Protein, WRN
Class: Hydrolase
Keywords: HRDC domain, Hydrolase
Deposited on 2006-10-25, released 2006-12-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.248
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Werner syndrome ATP-dependent helicase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2e1fa_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e1fA (A:)
    giqpvisaqeqetqivlygklvearqkhankmdvppailatnkilvdmakmrpttvenvk
    ridgvsegkaamlapllevikhfcqtnsvqtdlfsstkpqeeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e1fA (A:)
    qpvisaqeqetqivlygklvearqkhankmdvppailatnkilvdmakmrpttvenvkri
    dgvsegkaamlapllevikhfcqtnsvqtdlfss