PDB entry 2e1e

View 2e1e on RCSB PDB site
Description: Crystal structure of the HRDC Domain of Human Werner Syndrome Protein, WRN
Class: Hydrolase
Keywords: HRDC domain
Deposited on 2006-10-25, released 2006-12-12
The last revision prior to the SCOP 1.73 freeze date was dated 2006-12-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.253
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Werner syndrome ATP-dependent helicase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2e1ea1
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e1eA (A:)
    giqpvisaqeqetqivlygklvearqkhankmdvppailatnkilvdmakmrpttvenvk
    ridgvsegkaamlapllevikhfcqtnsvqtdlfsstkpqeeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e1eA (A:)
    qpvisaqeqetqivlygklvearqkhankmdvppailatnkilvdmakmrpttvenvkri
    dgvsegkaamlapllevikhfcqtnsvqtdlfss