PDB entry 2e1b

View 2e1b on RCSB PDB site
Description: Crystal structure of the AlaX-M trans-editing enzyme from Pyrococcus horikoshii
Class: ligase, hydrolase
Keywords: zinc-binding motif, trans-editing enzyme, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIGASE, HYDROLASE
Deposited on 2006-10-20, released 2007-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.227
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 216aa long hypothetical alanyl-tRNA synthetase
  Species: Pyrococcus horikoshii [TaxId:53953]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O57848 (0-215)
  Domains in SCOPe 2.07: d2e1ba1, d2e1ba2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2e1bA (A:)
  minmtrklyyedaylkeakgrvleirdnailldqtifyptgggqphdrgtingvevldvy
  kdeegnvwhvvkepekfkvgdevelkidwdyryklmrihtglhllehvlnevlgegnwql
  vgsgmsvekgrydiaypenlnkykeqiislfnkyvdeggevkiwwegdrrytqirdfevi
  pcggthvkdikeighikklkrssigrgkqrlemwle