PDB entry 2e1b

View 2e1b on RCSB PDB site
Description: Crystal structure of the AlaX-M trans-editing enzyme from Pyrococcus horikoshii
Class: ligase, hydrolase
Keywords: zinc-binding motif, trans-editing enzyme, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2006-10-20, released 2007-03-06
The last revision prior to the SCOP 1.75 freeze date was dated 2007-06-05, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.227
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 216aa long hypothetical alanyl-tRNA synthetase
    Species: Pyrococcus horikoshii
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2e1ba1, d2e1ba2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2e1bA (A:)
    minmtrklyyedaylkeakgrvleirdnailldqtifyptgggqphdrgtingvevldvy
    kdeegnvwhvvkepekfkvgdevelkidwdyryklmrihtglhllehvlnevlgegnwql
    vgsgmsvekgrydiaypenlnkykeqiislfnkyvdeggevkiwwegdrrytqirdfevi
    pcggthvkdikeighikklkrssigrgkqrlemwle