PDB entry 2e10

View 2e10 on RCSB PDB site
Description: Crystal Structure Of Biotin Protein Ligase From Pyrococcus Horikoshii, Mutation R51A
Class: ligase
Keywords: Biotin Biosynthesis, Dimer, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIGASE
Deposited on 2006-10-16, released 2007-04-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.209
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Biotin Protein Ligase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: birA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e10a1, d2e10a2
  • Chain 'B':
    Compound: Biotin Protein Ligase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: birA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e10b1, d2e10b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e10A (A:)
    mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnakwespeggl
    wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk
    gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
    lvrdnmilgvrvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e10A (A:)
    mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmgespegglwlsivlsp
    kkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegkivlgiglnvnnkvpn
    gatsmklelgsevpllsvfrslitnldrlylnflknpmdilnlvrdnmilgvrvkilgdg
    sfegiaediddfgrliirldsgevkkviygdvslrfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2e10B (B:)
    mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnakwespeggl
    wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk
    gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
    lvrdnmilgvrvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e10B (B:)
    mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmspegglwlsivlspkv
    pqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegkgdkivlgigl
    nvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdilnlvrdnmilgv
    rvkilgdgsfegiaediddfgrliirldsgevkkviyslrfl