PDB entry 2e0j

View 2e0j on RCSB PDB site
Description: Mutant Human Ribonuclease 1 (R31L, R32L)
Class: hydrolase
Keywords: Mutant Human Pancreatic Ribonuclease 1, HYDROLASE
Deposited on 2006-10-10, released 2007-08-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.191
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07998 (1-128)
      • engineered (31-32)
    Domains in SCOPe 2.05: d2e0ja_
  • Chain 'B':
    Compound: Ribonuclease
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07998 (1-128)
      • engineered (31-32)
    Domains in SCOPe 2.05: d2e0jb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e0jA (A:)
    mkesrakkfqrqhmdsdsspsssstycnqmmllrnmtqgrckpvntfvheplvdvqnvcf
    qekvtckngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvh
    fdasvedst
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e0jA (A:)
    kesrakkfqrqhmdsdsspsssstycnqmmllrnmtqgrckpvntfvheplvdvqnvcfq
    ekvtckngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvhf
    dasvedst
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2e0jB (B:)
    mkesrakkfqrqhmdsdsspsssstycnqmmllrnmtqgrckpvntfvheplvdvqnvcf
    qekvtckngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvh
    fdasvedst
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e0jB (B:)
    kesrakkfqrqhmdsdsspsssstycnqmmllrnmtqgrckpvntfvheplvdvqnvcfq
    ekvtckngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvhf
    dasvedst