PDB entry 2dzn

View 2dzn on RCSB PDB site
Description: Crystal structure analysis of yeast Nas6p complexed with the proteasome subunit, rpt3
Class: protein binding
Keywords: ankyrin repeats, a-helical domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2006-09-29, released 2007-07-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.197
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable 26S proteasome regulatory subunit p28
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2dzna_
  • Chain 'B':
    Compound: 26S protease regulatory subunit 6B homolog
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Probable 26S proteasome regulatory subunit p28
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2dznc_
  • Chain 'D':
    Compound: 26S protease regulatory subunit 6B homolog
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Probable 26S proteasome regulatory subunit p28
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2dzne_
  • Chain 'F':
    Compound: 26S protease regulatory subunit 6B homolog
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dznA (A:)
    msnyplhqacmeneffkvqellhskpslllqkdqdgriplhwsvsfqaheitsfllskme
    nvnlddypddsgwtpfhiacsvgnlevvkslydrplkpdlnkitnqgvtclhlavgkkwf
    evsqfliengasvrikdkfnqiplhraasvgslkliellcglgksavnwqdkqgwtplfh
    alaeghgdaavllvekygaeydlvdnkgakaedvalneqvkkfflnnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dznA (A:)
    nyplhqacmeneffkvqellhskpslllqkdqdgriplhwsvsfqaheitsfllskmenv
    nlddypddsgwtpfhiacsvgnlevvkslydrplkpdlnkitnqgvtclhlavgkkwfev
    sqfliengasvrikdkfnqiplhraasvgslkliellcglgksavnwqdkqgwtplfhal
    aeghgdaavllvekygaeydlvdnkgakaedvalneqvkkfflnnv
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2dznC (C:)
    msnyplhqacmeneffkvqellhskpslllqkdqdgriplhwsvsfqaheitsfllskme
    nvnlddypddsgwtpfhiacsvgnlevvkslydrplkpdlnkitnqgvtclhlavgkkwf
    evsqfliengasvrikdkfnqiplhraasvgslkliellcglgksavnwqdkqgwtplfh
    alaeghgdaavllvekygaeydlvdnkgakaedvalneqvkkfflnnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dznC (C:)
    snyplhqacmeneffkvqellhskpslllqkdqdgriplhwsvsfqaheitsfllskmen
    vnlddypddsgwtpfhiacsvgnlevvkslydrplkpdlnkitnqgvtclhlavgkkwfe
    vsqfliengasvrikdkfnqiplhraasvgslkliellcglgksavnwqdkqgwtplfha
    laeghgdaavllvekygaeydlvdnkgakaedvalneqvkkfflnnv
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2dznE (E:)
    msnyplhqacmeneffkvqellhskpslllqkdqdgriplhwsvsfqaheitsfllskme
    nvnlddypddsgwtpfhiacsvgnlevvkslydrplkpdlnkitnqgvtclhlavgkkwf
    evsqfliengasvrikdkfnqiplhraasvgslkliellcglgksavnwqdkqgwtplfh
    alaeghgdaavllvekygaeydlvdnkgakaedvalneqvkkfflnnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dznE (E:)
    snyplhqacmeneffkvqellhskpslllqkdqdgriplhwsvsfqaheitsfllskmen
    vnlddypddsgwtpfhiacsvgnlevvkslydrplkpdlnkitnqgvtclhlavgkkwfe
    vsqfliengasvrikdkfnqiplhraasvgslkliellcglgksavnwqdkqgwtplfha
    laeghgdaavllvekygaeydlvdnkgakaedvalneqvkkfflnnv
    

  • Chain 'F':
    No sequence available.