PDB entry 2dzi

View 2dzi on RCSB PDB site
Description: 2DZI/Solution Structure of the N-terminal Ubiquitin-like Domain in Human Ubiquitin-like Protein 4A (GDX)
Class: structural genomics, unknown function
Keywords: ubiquitin-like protein 4A, GDX, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2006-09-29, released 2007-03-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-like protein 4A
    Species: Homo sapiens [TaxId:9606]
    Gene: UBL4A, DXS254E, GDX, UBL4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11441 (7-80)
      • cloning artifact (0-6)
    Domains in SCOPe 2.04: d2dzia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dziA (A:)
    gssgssgmqltvkalqgrecslqvpedelvstlkqlvseklnvpvrqqrllfkgkaladg
    krlsdysigpnsklnlvvkpl