PDB entry 2dze

View 2dze on RCSB PDB site
Description: Crystal structure of histone chaperone Asf1 in complex with a C-terminus of histone H3
Class: chaperone
Keywords: Immunoglobulin fold, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CHAPERONE
Deposited on 2006-09-28, released 2007-10-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.215
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone chaperone cia1
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: cia1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2dzea_
  • Chain 'B':
    Compound: Histone chaperone cia1
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: cia1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2dzeb_
  • Chain 'X':
    Compound: 10-mer peptide from Histone H3.1/H3.2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dzeA (A:)
    msivnilsvnvlnnpakfsdpykfeitfecleplksdlewkltyvgsatsqsydqildtl
    lvgpipiginkfvfeadppnidllpqlsdvlgvtvillscayednefvrvgyyvnnemeg
    lnlqemddaeikkvkvdiskvwrsilaekprvtrfniqwdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dzeA (A:)
    msivnilsvnvlnnpakfsdpykfeitfecleplksdlewkltyvgsatsqsydqildtl
    lvgpipiginkfvfeadppnidllpqlsdvlgvtvillscayednefvrvgyyvnnemeg
    lnlqemddaeikkvkvdiskvwrsilaekprvtrfniqwd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2dzeB (B:)
    msivnilsvnvlnnpakfsdpykfeitfecleplksdlewkltyvgsatsqsydqildtl
    lvgpipiginkfvfeadppnidllpqlsdvlgvtvillscayednefvrvgyyvnnemeg
    lnlqemddaeikkvkvdiskvwrsilaekprvtrfniqwdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dzeB (B:)
    sivnilsvnvlnnpakfsdpykfeitfecleplksdlewkltyvgsatsqsydqildtll
    vgpipiginkfvfeadppnidllpqlsdvlgvtvillscayednefvrvgyyvnnemegl
    nlqemddaeikkvkvdiskvwrsilaekprvtrfniqwdn
    

  • Chain 'X':
    No sequence available.