PDB entry 2dyh

View 2dyh on RCSB PDB site
Description: Crystal structure of the Keap1 protein in complexed with the N-terminal region of the Nrf2 transcription factor
Class: transcription
Keywords: bet-propeller, Kelch motif, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2006-09-14, released 2007-09-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.174
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kelch-like ECH-associated protein 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2dyha_
  • Chain 'B':
    Compound: Nrf2/Neh2 peptide from Nuclear factor erythroid 2-related factor 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dyhA (A:)
    mtlhkptqavpcrapkvgrliytaggyfrqslsyleaynpsngswlrladlqvprsglag
    cvvggllyavggrnnspdgntdssaldcynpmtnqwspcasmsvprnrigvgvidghiya
    vggshgcihhssveryeperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsa
    ecyypernewrmitpmntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfv
    apmrhhrsalgitvhqgkiyvlggydghtfldsvecydpdsdtwsevtrmtsgrsgvgva
    vtmepcrkqidqqnctcy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dyhA (A:)
    vgrliytaggyfrqslsyleaynpsngswlrladlqvprsglagcvvggllyavggrnns
    pdgntdssaldcynpmtnqwspcasmsvprnrigvgvidghiyavggshgcihhssvery
    eperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitpm
    ntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmrhhrsalgitvhq
    gkiyvlggydghtfldsvecydpdsdtwsevtrmtsgrsgvgvavtmepcrkqidq
    

  • Chain 'B':
    No sequence available.