PDB entry 2dyf

View 2dyf on RCSB PDB site
Description: Solution structure of the first WW domain of FBP11 / HYPA (FBP11 WW1) complexed with a PL (PPLP) motif peptide ligand
Class: protein binding
Keywords: WW DOMAIN, COMPLEX, FBP11, HYPA, PL MOTIF, PPLP MOTIF, NMR, SOLUTION STRUCTURE, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses
Deposited on 2006-09-11, released 2006-10-24
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-24, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Huntingtin-interacting protein HYPA/FBP11
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75400 (2-29)
      • cloning artifact (0-1)
    Domains in SCOP 1.73: d2dyfa1
  • Chain 'B':
    Compound: PL (PPLP) motif peptide from Myosin tail region-interacting protein MTI1
    Species: Saccharomyces cerevisiae
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47068 (2-8)
      • cloning artifact (0-1)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dyfA (A:)
    gswtehkspdgrtyyyntetkqstwekpdd
    

  • Chain 'B':
    No sequence available.