PDB entry 2dyf

View 2dyf on RCSB PDB site
Description: Solution structure of the first WW domain of FBP11 / HYPA (FBP11 WW1) complexed with a PL (PPLP) motif peptide ligand
Class: protein binding
Keywords: WW DOMAIN, COMPLEX, FBP11, HYPA, PL MOTIF, PPLP MOTIF, NMR, SOLUTION STRUCTURE, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, PROTEIN BINDING
Deposited on 2006-09-11, released 2006-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Huntingtin-interacting protein HYPA/FBP11
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75400 (2-29)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d2dyfa2, d2dyfa3
  • Chain 'B':
    Compound: PL (PPLP) motif peptide from Myosin tail region-interacting protein MTI1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47068 (2-8)
      • cloning artifact (0-1)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dyfA (A:)
    gswtehkspdgrtyyyntetkqstwekpdd
    

  • Chain 'B':
    No sequence available.