PDB entry 2dyc

View 2dyc on RCSB PDB site
Description: Crystal structure of the N-terminal domain of mouse galectin-4
Class: sugar binding protein
Keywords: GAL-BIND LECTIN, GALECTIN, SUGAR BINDING, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SUGAR BINDING PROTEIN
Deposited on 2006-09-08, released 2007-10-16
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.22
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-4
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2dyca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2dycA (A:)
gssgssgyqptynptlpykrpipgglsvgmsvyiqgmakenmrrfhvnfavgqddgadva
fhfnprfdgwdkvvfntmqsgqwgkeekkksmpfqkgkhfelvfmvmpehykvvvngnsf
yeyghrlpvqmvthlqvdgdlelqsinflggqpaaapy

    Sequence, based on observed residues (ATOM records): (download) 
    >2dycA (A:)
ynptlpykrpipgglsvgmsvyiqgmakenmrrfhvnfavgqddgadvafhfnprfdgwd
kvvfntmqsgqwgkeekkksmpfqkgkhfelvfmvmpehykvvvngnsfyeyghrlpvqm
vthlqvdgdlelqsinflggqpaaapy