PDB entry 2dy7

View 2dy7 on RCSB PDB site
Description: Solution structure of the first chromodomain of yeast Chd1
Class: hydrolase
Keywords: Chromatin remodeling
Deposited on 2006-09-07, released 2006-11-28
The last revision prior to the SCOP 1.73 freeze date was dated 2007-01-16, with a file datestamp of 2007-07-20.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromo domain protein 1
    Species: Saccharomyces cerevisiae
    Gene: CHD1/YER164W
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2dy7a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2dy7A (A:)
qpedfhgidivinhrlktsleegkvlektvpdlnnckenyeflikwtdeshlhntwetye
sigqvrglkrldnyckqfiie