PDB entry 2dy5

View 2dy5 on RCSB PDB site
Description: Crystal structure of rat heme oxygenase-1 in complex with heme and 2-[2-(4-chlorophenyl)ethyl]-2-[(1H-imidazol-1-yl)methyl]-1,3-dioxolane
Class: oxidoreductase
Keywords: inhibitor, substrate bound structure, oxidoreductase
Deposited on 2006-09-06, released 2007-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.194
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme oxygenase 1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dy5a_
  • Heterogens: CL, HEM, 224, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dy5A (A:)
    merpqldsmsqdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiyta
    leeeiernkqnpvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhe
    vggthpellvahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkq
    lyrarmntlemtpevkhrvteeaktafllnielfeelqallteehkdqspsqteflrqrp
    aslvqdttsaetprgksqistsssqtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dy5A (A:)
    sqdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiytaleeeiernk
    qnpvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhevggthpell
    vahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkqlyrarmntl
    emtpevkhrvteeaktafllnielfeelqallte