PDB entry 2dxt

View 2dxt on RCSB PDB site
Description: Crystal Structure Of Biotin Protein Ligase From Pyrococcus Horikoshii Complexed with ATP and Biotin, Mutation D104A
Class: ligase
Keywords: Biotin Biosynthesis, Dimer, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIGASE
Deposited on 2006-08-30, released 2007-03-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.188
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: biotin--[acetyl-CoA-carboxylase] ligase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: birA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57883 (0-234)
      • engineered (103)
    Domains in SCOPe 2.03: d2dxta1, d2dxta2
  • Chain 'B':
    Compound: biotin--[acetyl-CoA-carboxylase] ligase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: birA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57883 (0-234)
      • engineered (103)
    Domains in SCOPe 2.03: d2dxtb1, d2dxtb2
  • Heterogens: ATP, BTN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dxtA (A:)
    mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
    wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpnavlvnykkiagvlvegk
    gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
    lvrdnmilgvrvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dxtB (B:)
    mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
    wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpnavlvnykkiagvlvegk
    gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
    lvrdnmilgvrvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl