PDB entry 2dxe

View 2dxe on RCSB PDB site
Description: Crystal structure of nucleoside diphosphate kinase in complex with GDP
Class: transferase
Keywords: nucleoside binding, kinase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2006-08-25, released 2007-02-25
The last revision prior to the SCOP 1.73 freeze date was dated 2007-02-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.168
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: Pyrococcus horikoshii
    Gene: ndk
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2dxea1
  • Chain 'B':
    Compound: Nucleoside diphosphate kinase
    Species: Pyrococcus horikoshii
    Gene: ndk
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2dxeb1
  • Heterogens: MG, CL, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dxeA (A:)
    mfqmsetertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehre
    kpffkalidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaic
    nvihasdskesaereislffkpeelfeypraadwfykkgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dxeA (A:)
    etertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehrekpffk
    alidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaicnviha
    sdskesaereislffkpeelfeypraadwfykkg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2dxeB (B:)
    mfqmsetertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehre
    kpffkalidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaic
    nvihasdskesaereislffkpeelfeypraadwfykkgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dxeB (B:)
    setertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehrekpff
    kalidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaicnvih
    asdskesaereislffkpeelfeypraadwfykkgi