PDB entry 2dwz

View 2dwz on RCSB PDB site
Description: Structure of the Oncoprotein Gankyrin in Complex with S6 ATPase of the 26S Proteasome
Class: oncoprotein
Keywords: ANKYRIN REPEATS, A-HELICAL DOMAIN, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, ONCOPROTEIN
Deposited on 2006-08-22, released 2007-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.194
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 26S proteasome non-ATPase regulatory subunit 10
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dwza_
  • Chain 'B':
    Compound: 26S protease regulatory subunit 6B
    Species: Rattus norvegicus [TaxId:10116]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 26S proteasome non-ATPase regulatory subunit 10
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dwzc_
  • Chain 'D':
    Compound: 26S protease regulatory subunit 6B
    Species: Rattus norvegicus [TaxId:10116]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dwzA (A:)
    megcvsnimicnlaysgkldelkeriladkslatrtdqdsrtalhwacsaghteivefll
    qlgvpvndkddagwsplhiaasagrdeivkallvkgahvnavnqngctplhyaasknrhe
    iavmllegganpdakdhydatamhraaakgnlkmvhillfykastniqdtegntplhlac
    deerveeakflvtqgasiyienkeektplqvakgglglilkrlaegeeasm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dwzA (A:)
    cvsnimicnlaysgkldelkeriladkslatrtdqdsrtalhwacsaghteivefllqlg
    vpvndkddagwsplhiaasagrdeivkallvkgahvnavnqngctplhyaasknrheiav
    mllegganpdakdhydatamhraaakgnlkmvhillfykastniqdtegntplhlacdee
    rveeakflvtqgasiyienkeektplqvakgglglilkrlaegeea
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2dwzC (C:)
    megcvsnimicnlaysgkldelkeriladkslatrtdqdsrtalhwacsaghteivefll
    qlgvpvndkddagwsplhiaasagrdeivkallvkgahvnavnqngctplhyaasknrhe
    iavmllegganpdakdhydatamhraaakgnlkmvhillfykastniqdtegntplhlac
    deerveeakflvtqgasiyienkeektplqvakgglglilkrlaegeeasm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dwzC (C:)
    cvsnimicnlaysgkldelkeriladkslatrtdqdsrtalhwacsaghteivefllqlg
    vpvndkddagwsplhiaasagrdeivkallvkgahvnavnqngctplhyaasknrheiav
    mllegganpdakdhydatamhraaakgnlkmvhillfykastniqdtegntplhlacdee
    rveeakflvtqgasiyienkeektplqvakgglglilkrlaegeea
    

  • Chain 'D':
    No sequence available.