PDB entry 2dww

View 2dww on RCSB PDB site
Description: Crystal structure of Bromodomain-containing protein 4
Class: transcription
Keywords: alpha-helical domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2006-08-21, released 2007-08-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.189
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 4
    Species: Mus musculus [TaxId:10090]
    Gene: Brd4, Mcap
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ESU6 (0-113)
      • modified residue (18)
      • modified residue (52)
      • modified residue (54)
      • modified residue (79)
      • modified residue (96)
      • modified residue (106)
      • modified residue (111)
    Domains in SCOPe 2.08: d2dwwa_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dwwA (A:)
    ksskiseqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmstiks
    klesreyrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakmpd