PDB entry 2dwq

View 2dwq on RCSB PDB site
Description: Thermus thermophilus YchF GTP-binding protein
Class: hydrolase
Keywords: GTP-binding, signal transduction, TGS domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, HYDROLASE
Deposited on 2006-08-16, released 2007-02-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.208
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding protein
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2dwqa1, d2dwqa2
  • Chain 'B':
    Compound: GTP-binding protein
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2dwqb1, d2dwqb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dwqA (A:)
    mlavgivglpnvgkstlfnaltranalaanypfatidknvgvvplederlyalqrtfakg
    ervppvvpthvefvdiaglvkgahkgeglgnqflahirevaaiahvlrcfpdpdvvhvmg
    rvdpledaevvetellladlatlerrlerlrkearadrerlplleaaeglyvhlqegkpa
    rtfppseavarflketplltakpviyvanvaeedlpdgrgnpqveavrrkaleegaevvv
    vsarleaelaelsgeearellaayglqesglqrlaragyraldlltfftagekevrawtv
    rrgtkapraageihsdmergfiraevipwdklveaggwarakergwvrlegkdyevqdgd
    viyvlfna
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dwqA (A:)
    mlavgivglpnvgkstlfnaltranalaatidknvgvvplederlyalqrtfakgervpp
    vvpthvefvdiaglvkgahkgeglgnqflahirevaaiahvlrcfpdpdpledaevvete
    llladlatlerrlerlrkearadrerlplleaaeglyvhlqegkpartfppseavarflk
    etplltakpviyvanvaeedlpdgrgnpqveavrrkaleegaevvvvsarleaelaelsg
    eearellaayglqesglqrlaragyraldlltfftagekevrawtvrrgtkapraageih
    sdmergfiraevipwdklveaggwarakergwvrlegkdyevqdgdviyvlfna
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2dwqB (B:)
    mlavgivglpnvgkstlfnaltranalaanypfatidknvgvvplederlyalqrtfakg
    ervppvvpthvefvdiaglvkgahkgeglgnqflahirevaaiahvlrcfpdpdvvhvmg
    rvdpledaevvetellladlatlerrlerlrkearadrerlplleaaeglyvhlqegkpa
    rtfppseavarflketplltakpviyvanvaeedlpdgrgnpqveavrrkaleegaevvv
    vsarleaelaelsgeearellaayglqesglqrlaragyraldlltfftagekevrawtv
    rrgtkapraageihsdmergfiraevipwdklveaggwarakergwvrlegkdyevqdgd
    viyvlfna
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dwqB (B:)
    lavgivglpnvgkstlfnaltranalaknvgvvplederlyalqrtfakgervppvvpth
    vefvdiaglvnqflahirevaaiahvlrcfpdpledaevvetellladlatlerrlerlr
    kearadrerlplleaaeglyvhlqegkpartfppseavarflketplltakpviyvanva
    eedlpdgrgnpqveavrrkaleegaevvvvsarleaelaelsgeearellaayglqesgl
    qrlaragyraldlltfftagekevrawtvrrgtkapraageihsdmergfiraevipwdk
    lveaggwarakergwvrlegkdyevqdgdviyvlfna