PDB entry 2dwe

View 2dwe on RCSB PDB site
Description: Crystal structure of KcsA-FAB-TBA complex in Rb+
Class: membrane protein
Keywords: POTASSIUM CHANNEL, MEMBRANE PROTEIN, TETRABUTYLAMMONIUM, K+, KcsA
Deposited on 2006-08-10, released 2007-02-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.23
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2DWE (0-218)
    Domains in SCOPe 2.06: d2dwea1, d2dwea2
  • Chain 'B':
    Compound: antibody fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2DWE (0-211)
    Domains in SCOPe 2.06: d2dweb1, d2dweb2
  • Chain 'C':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (0-102)
      • engineered (68)
    Domains in SCOPe 2.06: d2dwec_
  • Heterogens: RB, L2C, F09, TBA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dweA (A:)
    qvqlqqpgaelvkpgasvklsckasgytftsdwihwvkqrpghglewigeiipsygrany
    nekiqkkatltadkssstafmqlssltsedsavyycarergdgyfavwgagttvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpssswpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dweB (B:)
    dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
    rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dweC (C:)
    salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
    ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh