PDB entry 2dwd

View 2dwd on RCSB PDB site
Description: crystal structure of KcsA-FAB-TBA complex in Tl+
Class: membrane protein
Keywords: potassium channel, membrane protein, tetrabutylammonium, K+, KcsA
Deposited on 2006-08-10, released 2007-02-20
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.219
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: antibody fab heavy chain
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 2DWD (0-218)
• Chain 'B':
  Compound: antibody fab light chain
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 2DWD (0-211)
• Chain 'C':
  Compound: Voltage-gated potassium channel
  Species: Streptomyces lividans [TaxId:1916]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A334 (0-102)
    • engineered (68)
  Domains in SCOPe 2.01: d2dwdc_
• Heterogens: TL, L2C, F09, TBA, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dwdC (C:)
  salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
  ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh