PDB entry 2dwb

View 2dwb on RCSB PDB site
Description: Aurora-A kinase complexed with AMPPNP
Class: Transferase
Keywords: Aurora, protein kinase, ATP-binding, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Transferase
Deposited on 2006-08-10, released 2007-07-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.227
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14965
      • modified residue (181)
      • modified residue (186)
      • modified residue (254)
    Domains in SCOPe 2.05: d2dwba_
  • Heterogens: SO4, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dwbA (A:)
    ghmeskkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehql
    rreveiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyit
    elanalsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylpp
    emiegrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegard
    lisrllkhnpsqrpmlrevlehpwitansskpsncqnkesaskqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dwbA (A:)
    rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
    shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
    ychskrvihrdikpenlllgsagelkiadfgwsvhapssrtlcgtldylppemiegrmhd
    ekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhn
    psqrpmlrevlehpwitanssk