PDB entry 2dw7

View 2dw7 on RCSB PDB site
Description: Crystal structure of D-tartrate dehydratase from Bradyrhizobium japonicum complexed with Mg++ and meso-tartrate
Class: lyase
Keywords: D-tartrate dehydratase, Enolase superfamily, meso-tartrate, LYASE
Deposited on 2006-08-07, released 2006-12-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.241
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bll6730 protein
    Species: BRADYRHIZOBIUM JAPONICUM [TaxId:375]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2dw7a1, d2dw7a2
  • Chain 'B':
    Compound: Bll6730 protein
    Species: BRADYRHIZOBIUM JAPONICUM [TaxId:375]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2dw7b1, d2dw7b2
  • Chain 'C':
    Compound: Bll6730 protein
    Species: BRADYRHIZOBIUM JAPONICUM [TaxId:375]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2dw7c1, d2dw7c2
  • Chain 'D':
    Compound: Bll6730 protein
    Species: BRADYRHIZOBIUM JAPONICUM [TaxId:375]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2dw7d1, d2dw7d2
  • Chain 'E':
    Compound: Bll6730 protein
    Species: BRADYRHIZOBIUM JAPONICUM [TaxId:375]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2dw7e1, d2dw7e2
  • Chain 'F':
    Compound: Bll6730 protein
    Species: BRADYRHIZOBIUM JAPONICUM [TaxId:375]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2dw7f1, d2dw7f2
  • Chain 'G':
    Compound: Bll6730 protein
    Species: BRADYRHIZOBIUM JAPONICUM [TaxId:375]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2dw7g1, d2dw7g2
  • Chain 'H':
    Compound: Bll6730 protein
    Species: BRADYRHIZOBIUM JAPONICUM [TaxId:375]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2dw7h1, d2dw7h2
  • Chain 'I':
    Compound: Bll6730 protein
    Species: BRADYRHIZOBIUM JAPONICUM [TaxId:375]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2dw7i1, d2dw7i2
  • Chain 'J':
    Compound: Bll6730 protein
    Species: BRADYRHIZOBIUM JAPONICUM [TaxId:375]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2dw7j1, d2dw7j2
  • Chain 'K':
    Compound: Bll6730 protein
    Species: BRADYRHIZOBIUM JAPONICUM [TaxId:375]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2dw7k1, d2dw7k2
  • Chain 'L':
    Compound: Bll6730 protein
    Species: BRADYRHIZOBIUM JAPONICUM [TaxId:375]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2dw7l1, d2dw7l2
  • Chain 'M':
    Compound: Bll6730 protein
    Species: BRADYRHIZOBIUM JAPONICUM [TaxId:375]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2dw7m1, d2dw7m2
  • Chain 'N':
    Compound: Bll6730 protein
    Species: BRADYRHIZOBIUM JAPONICUM [TaxId:375]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2dw7n1, d2dw7n2
  • Chain 'O':
    Compound: Bll6730 protein
    Species: BRADYRHIZOBIUM JAPONICUM [TaxId:375]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2dw7o1, d2dw7o2
  • Chain 'P':
    Compound: Bll6730 protein
    Species: BRADYRHIZOBIUM JAPONICUM [TaxId:375]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2dw7p1, d2dw7p2
  • Heterogens: MG, SRT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dw7A (A:)
    msvrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygq
    gglirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmav
    wdavakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynv
    vkmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyee
    vgdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglc
    eyqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrve
    nghitmpdlpgigfegksdlykemkalae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dw7A (A:)
    svrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygqg
    glirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavw
    davakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynvv
    kmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyeev
    gdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglce
    yqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrven
    ghitmpdlpgigfegksdlykemkalae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2dw7B (B:)
    msvrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygq
    gglirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmav
    wdavakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynv
    vkmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyee
    vgdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglc
    eyqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrve
    nghitmpdlpgigfegksdlykemkalae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dw7B (B:)
    svrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygqg
    glirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavw
    davakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynvv
    kmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyeev
    gdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglce
    yqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrven
    ghitmpdlpgigfegksdlykemkalae
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2dw7C (C:)
    msvrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygq
    gglirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmav
    wdavakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynv
    vkmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyee
    vgdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglc
    eyqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrve
    nghitmpdlpgigfegksdlykemkalae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dw7C (C:)
    svrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygqg
    glirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavw
    davakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynvv
    kmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyeev
    gdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglce
    yqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrven
    ghitmpdlpgigfegksdlykemkalae
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2dw7D (D:)
    msvrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygq
    gglirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmav
    wdavakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynv
    vkmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyee
    vgdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglc
    eyqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrve
    nghitmpdlpgigfegksdlykemkalae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dw7D (D:)
    svrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygqg
    glirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavw
    davakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynvv
    kmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyeev
    gdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglce
    yqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrven
    ghitmpdlpgigfegksdlykemkalae
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2dw7E (E:)
    msvrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygq
    gglirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmav
    wdavakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynv
    vkmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyee
    vgdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglc
    eyqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrve
    nghitmpdlpgigfegksdlykemkalae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dw7E (E:)
    svrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygqg
    glirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavw
    davakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynvv
    kmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyeev
    gdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglce
    yqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrven
    ghitmpdlpgigfegksdlykemkalae
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2dw7F (F:)
    msvrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygq
    gglirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmav
    wdavakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynv
    vkmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyee
    vgdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglc
    eyqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrve
    nghitmpdlpgigfegksdlykemkalae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dw7F (F:)
    svrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygqg
    glirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavw
    davakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynvv
    kmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyeev
    gdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglce
    yqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrven
    ghitmpdlpgigfegksdlykemkalae
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2dw7G (G:)
    msvrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygq
    gglirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmav
    wdavakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynv
    vkmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyee
    vgdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglc
    eyqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrve
    nghitmpdlpgigfegksdlykemkalae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dw7G (G:)
    svrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygqg
    glirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavw
    davakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynvv
    kmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyeev
    gdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglce
    yqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrven
    ghitmpdlpgigfegksdlykemkalae
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2dw7H (H:)
    msvrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygq
    gglirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmav
    wdavakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynv
    vkmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyee
    vgdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglc
    eyqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrve
    nghitmpdlpgigfegksdlykemkalae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dw7H (H:)
    svrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygqg
    glirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavw
    davakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynvv
    kmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyeev
    gdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglce
    yqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrven
    ghitmpdlpgigfegksdlykemkalae
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2dw7I (I:)
    msvrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygq
    gglirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmav
    wdavakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynv
    vkmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyee
    vgdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglc
    eyqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrve
    nghitmpdlpgigfegksdlykemkalae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dw7I (I:)
    svrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygqg
    glirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavw
    davakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynvv
    kmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyeev
    gdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglce
    yqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrven
    ghitmpdlpgigfegksdlykemkalae
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2dw7J (J:)
    msvrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygq
    gglirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmav
    wdavakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynv
    vkmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyee
    vgdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglc
    eyqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrve
    nghitmpdlpgigfegksdlykemkalae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dw7J (J:)
    svrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygqg
    glirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavw
    davakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynvv
    kmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyeev
    gdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglce
    yqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrven
    ghitmpdlpgigfegksdlykemkalae
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2dw7K (K:)
    msvrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygq
    gglirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmav
    wdavakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynv
    vkmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyee
    vgdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglc
    eyqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrve
    nghitmpdlpgigfegksdlykemkalae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dw7K (K:)
    svrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygqg
    glirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavw
    davakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynvv
    kmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyeev
    gdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglce
    yqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrven
    ghitmpdlpgigfegksdlykemkalae
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2dw7L (L:)
    msvrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygq
    gglirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmav
    wdavakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynv
    vkmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyee
    vgdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglc
    eyqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrve
    nghitmpdlpgigfegksdlykemkalae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dw7L (L:)
    svrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygqg
    glirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavw
    davakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynvv
    kmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyeev
    gdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglce
    yqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrven
    ghitmpdlpgigfegksdlykemkalae
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2dw7M (M:)
    msvrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygq
    gglirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmav
    wdavakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynv
    vkmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyee
    vgdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglc
    eyqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrve
    nghitmpdlpgigfegksdlykemkalae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dw7M (M:)
    svrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygqg
    glirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavw
    davakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynvv
    kmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyeev
    gdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglce
    yqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrven
    ghitmpdlpgigfegksdlykemkalae
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2dw7N (N:)
    msvrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygq
    gglirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmav
    wdavakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynv
    vkmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyee
    vgdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglc
    eyqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrve
    nghitmpdlpgigfegksdlykemkalae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dw7N (N:)
    svrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygqg
    glirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavw
    davakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynvv
    kmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyeev
    gdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglce
    yqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrven
    ghitmpdlpgigfegksdlykemkalae
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2dw7O (O:)
    msvrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygq
    gglirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmav
    wdavakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynv
    vkmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyee
    vgdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglc
    eyqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrve
    nghitmpdlpgigfegksdlykemkalae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dw7O (O:)
    svrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygqg
    glirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavw
    davakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynvv
    kmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyeev
    gdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglce
    yqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrven
    ghitmpdlpgigfegksdlykemkalae
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2dw7P (P:)
    msvrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygq
    gglirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmav
    wdavakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynv
    vkmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyee
    vgdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglc
    eyqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrve
    nghitmpdlpgigfegksdlykemkalae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dw7P (P:)
    svrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygqg
    glirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavw
    davakiagkplfrllaerhgvkanprvfvyaaggyyypgkglsmlrgemrgyldrgynvv
    kmkiggapieedrmrieavleeigkdaqlavdangrfnletgiayakmlrdyplfwyeev
    gdpldyalqaalaefypgpmatgenlfshqdarnllryggmrpdrdwlqfdcalsyglce
    yqrtlevlkthgwspsrciphgghqmslniaaglglggnesypdlfqpyggfpdgvrven
    ghitmpdlpgigfegksdlykemkalae