PDB entry 2dw5

View 2dw5 on RCSB PDB site
Description: Crystal structure of human peptidylarginine deiminase 4 in complex with N-alpha-benzoyl-N5-(2-fluoro-1-iminoethyl)-L-ornithine amide
Class: hydrolase
Keywords: protein-inhibitor complex, HYDROLASE
Deposited on 2006-08-04, released 2006-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein-arginine deiminase type-4
    Species: Homo sapiens [TaxId:9606]
    Gene: PADI4, PADI5, PDI5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dw5a1, d2dw5a2, d2dw5a3
  • Heterogens: CA, SO4, BFB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dw5A (A:)
    gplgspefmaqgtlirvtpeqpthavcvlgtltqldicssapedctsfsinaspgvvvdi
    ahsppakkkstgsstwpldpgvevtltmkaasgstgdqkvqisyygpktppvkallylta
    veislcaditrtgkvkptravkdqrtwtwgpcgqgaillvncdrdnlessamdceddevl
    dsedlqdmslmtlstktpkdfftnhtlvlhvarsemdkvrvfqatrgklsskcsvvlgpk
    wpshylmvpggkhnmdfyvealafpdtdfpglitltislldtsnlelpeavvfqdsvvfr
    vapwimtpntqppqevyacsifenedflksvttlamkakcklticpeeenmddqwmqdem
    eigyiqaphktlpvvfdsprnrglkefpikrvmgpdfgyvtrgpqtggisgldsfgnlev
    sppvtvrgkeyplgrilfgdscypsndsrqmhqalqdflsaqqvqapvklysdwlsvghv
    deflsfvpapdrkgfrlllasprscyklfqeqqneghgeallfegikkkkqqkiknilsn
    ktlrehnsfvercidwnrellkrelglaesdiidipqlfklkefskaeaffpnmvnmlvl
    gkhlgipkpfgpvingrccleekvcslleplglqctfindfftyhirhgevhcgtnvrrk
    pfsfkwwnmvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dw5A (A:)
    gtlirvtpeqpthavcvlgtltqldicssapetsfsinaspgvvvditwpldpgvevtlt
    mkaasgstgdqkvqisyygpktppvkallyltaveislcaditrtgkqrtwtwgpcgqga
    illvncdrdnlessamdceddevldsedlqdmslmtlstktpkdfftnhtlvlhvarsem
    dkvrvfqatcsvvlgpkwpshylmvpggkhnmdfyvealafpdtdfpglitltislldts
    nlelpeavvfqdsvvfrvapwimtpntqppqevyacsenedflksvttlamkakckltic
    peeenmddqwmqdemeigyiqaphktlpvvfdsprnrglkefpikrvmgpdfgyvtrgpq
    tggisgldsfgnlevsppvtvrgkeyplgrilfgdscypsndsrqmhqalqdflsaqqvq
    apvklysdwlsvghvdeflsfvpapdrkgfrlllasprscyklfqeqqneghgeallfeg
    ikkkkqqkiknilsnktlrehnsfvercidwnrellkrelglaesdiidipqlfklkefs
    kaeaffpnmvnmlvlgkhlgipkpfgpvingrccleekvcslleplglqctfindfftyh
    irhgevhcgtnvrrkpfsfkwwnmvp