PDB entry 2dvx

View 2dvx on RCSB PDB site
Description: Crystal Structure of 2,6-Dihydroxybenzoate Decarboxylase Complexed with inhibitor 2,3-dihydroxybenzaldehyde
Class: lyase
Keywords: tim barrel
Deposited on 2006-08-01, released 2006-09-19
The last revision prior to the SCOP 1.73 freeze date was dated 2006-09-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.184
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermophilic reversible gamma-resorcylate decarboxylase
    Species: Rhizobium sp.
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2dvxa1
  • Chain 'B':
    Compound: Thermophilic reversible gamma-resorcylate decarboxylase
    Species: Rhizobium sp.
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2dvxb1
  • Chain 'C':
    Compound: Thermophilic reversible gamma-resorcylate decarboxylase
    Species: Rhizobium sp.
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2dvxc1
  • Chain 'D':
    Compound: Thermophilic reversible gamma-resorcylate decarboxylase
    Species: Rhizobium sp.
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2dvxd1
  • Heterogens: ZN, 23A, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dvxA (A:)
    mqgkvaleehfaipetlqdsagfvpgdywkelqhrlldiqdtrlklmdahgietmilsln
    apavqaipdrrkaieiarrandvlaeecakrpdrflafaalplqdpdaateelqrcvndl
    gfvgalvngfsqegdgqtplyydlpqyrpfwgevekldvpfylhprnplpqdsriydghp
    wllgptwafaqetavhalrlmasglfdehprlniilghmgeglpymmwridhrnawvklp
    prypakrrfmdyfnenfhittsgnfrtqtlidaileigadrilfstdwpfenidhasdwf
    natsiaeadrvkigrtnarrlfkldga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dvxA (A:)
    mqgkvaleehfaipetlqdsagfvpgdywkelqhrlldiqdtrlklmdahgietmilsln
    apavqaipdrrkaieiarrandvlaeecakrpdrflafaalplqdpdaateelqrcvndl
    gfvgalvngfsqegdgqtplyydlpqyrpfwgevekldvpfylhprnplpqdsriydghp
    wllgptwafaqetavhalrlmasglfdehprlniilghmgeglpymmwridhrnawvklp
    prypakrrfmdyfnenfhittsgnfrtqtlidaileigadrilfstdwpfenidhasdwf
    natsiaeadrvkigrtnarrlfkld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2dvxB (B:)
    mqgkvaleehfaipetlqdsagfvpgdywkelqhrlldiqdtrlklmdahgietmilsln
    apavqaipdrrkaieiarrandvlaeecakrpdrflafaalplqdpdaateelqrcvndl
    gfvgalvngfsqegdgqtplyydlpqyrpfwgevekldvpfylhprnplpqdsriydghp
    wllgptwafaqetavhalrlmasglfdehprlniilghmgeglpymmwridhrnawvklp
    prypakrrfmdyfnenfhittsgnfrtqtlidaileigadrilfstdwpfenidhasdwf
    natsiaeadrvkigrtnarrlfkldga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dvxB (B:)
    mqgkvaleehfaipetlqdsagfvpgdywkelqhrlldiqdtrlklmdahgietmilsln
    apavqaipdrrkaieiarrandvlaeecakrpdrflafaalplqdpdaateelqrcvndl
    gfvgalvngfsqegdgqtplyydlpqyrpfwgevekldvpfylhprnplpqdsriydghp
    wllgptwafaqetavhalrlmasglfdehprlniilghmgeglpymmwridhrnawvklp
    prypakrrfmdyfnenfhittsgnfrtqtlidaileigadrilfstdwpfenidhasdwf
    natsiaeadrvkigrtnarrlfkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2dvxC (C:)
    mqgkvaleehfaipetlqdsagfvpgdywkelqhrlldiqdtrlklmdahgietmilsln
    apavqaipdrrkaieiarrandvlaeecakrpdrflafaalplqdpdaateelqrcvndl
    gfvgalvngfsqegdgqtplyydlpqyrpfwgevekldvpfylhprnplpqdsriydghp
    wllgptwafaqetavhalrlmasglfdehprlniilghmgeglpymmwridhrnawvklp
    prypakrrfmdyfnenfhittsgnfrtqtlidaileigadrilfstdwpfenidhasdwf
    natsiaeadrvkigrtnarrlfkldga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dvxC (C:)
    mqgkvaleehfaipetlqdsvpgdywkelqhrlldiqdtrlklmdahgietmilslnapa
    vqaipdrrkaieiarrandvlaeecakrpdrflafaalplqdpdaateelqrcvndlgfv
    galvngfsqegdgqtplyydlpqyrpfwgevekldvpfylhprnplpqdsriydghpwll
    gptwafaqetavhalrlmasglfdehprlniilghmgeglpymmwridhrnawvklppry
    pakrrfmdyfnenfhittsgnfrtqtlidaileigadrilfstdwpfenidhasdwfnat
    siaeadrvkigrtnarrlfkldg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2dvxD (D:)
    mqgkvaleehfaipetlqdsagfvpgdywkelqhrlldiqdtrlklmdahgietmilsln
    apavqaipdrrkaieiarrandvlaeecakrpdrflafaalplqdpdaateelqrcvndl
    gfvgalvngfsqegdgqtplyydlpqyrpfwgevekldvpfylhprnplpqdsriydghp
    wllgptwafaqetavhalrlmasglfdehprlniilghmgeglpymmwridhrnawvklp
    prypakrrfmdyfnenfhittsgnfrtqtlidaileigadrilfstdwpfenidhasdwf
    natsiaeadrvkigrtnarrlfkldga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dvxD (D:)
    mqgkvaleehfaipetlqdsvpgdywkelqhrlldiqdtrlklmdahgietmilslnapa
    vqaipdrrkaieiarrandvlaeecakrpdrflafaalplqdpdaateelqrcvndlgfv
    galvngfsqegdgqtplyydlpqyrpfwgevekldvpfylhprnplpqdsriydghpwll
    gptwafaqetavhalrlmasglfdehprlniilghmgeglpymmwridhrnawvklppry
    pakrrfmdyfnenfhittsgnfrtqtlidaileigadrilfstdwpfenidhasdwfnat
    siaeadrvkigrtnarrlfkl