PDB entry 2dvv

View 2dvv on RCSB PDB site
Description: Crystal structure of the second bromodomain of the human Brd2 protein
Class: transcription
Keywords: bromodomain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2006-08-01, released 2007-08-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Bromodomain-containing protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: BRD2, KIAA9001, RING3
  Database cross-references and differences (RAF-indexed):
  • Uniprot P25440 (4-111)
    • cloning artifact (0-3)
  Domains in SCOPe 2.04: d2dvva_
• Heterogens: EPE, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dvvA (A:)
  gshmeqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkm
  enrdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd