PDB entry 2dvu

View 2dvu on RCSB PDB site
Description: Crystal Structure of 2,6-Dihydroxybenzoate Decarboxylase Complexed with 2,6-Dihydroxybenzoate
Class: lyase
Keywords: tim barrel
Deposited on 2006-08-01, released 2006-09-19
The last revision prior to the SCOP 1.73 freeze date was dated 2006-09-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.176
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermophilic reversible gamma-resorcylate decarboxylase
    Species: Rhizobium sp.
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2dvua1
  • Chain 'B':
    Compound: Thermophilic reversible gamma-resorcylate decarboxylase
    Species: Rhizobium sp.
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2dvub1
  • Chain 'C':
    Compound: Thermophilic reversible gamma-resorcylate decarboxylase
    Species: Rhizobium sp.
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2dvuc1
  • Chain 'D':
    Compound: Thermophilic reversible gamma-resorcylate decarboxylase
    Species: Rhizobium sp.
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2dvud1
  • Heterogens: ZN, GRE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dvuA (A:)
    mqgkvaleehfaipetlqdsagfvpgdywkelqhrlldiqdtrlklmdahgietmilsln
    apavqaipdrrkaieiarrandvlaeecakrpdrflafaalplqdpdaateelqrcvndl
    gfvgalvngfsqegdgqtplyydlpqyrpfwgevekldvpfylhprnplpqdsriydghp
    wllgptwafaqetavhalrlmasglfdehprlniilghmgeglpymmwridhrnawvklp
    prypakrrfmdyfnenfhittsgnfrtqtlidaileigadrilfstdwpfenidhasdwf
    natsiaeadrvkigrtnarrlfkldga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dvuA (A:)
    mqgkvaleehfaipetlqdsagfvpgdywkelqhrlldiqdtrlklmdahgietmilsln
    apavqaipdrrkaieiarrandvlaeecakrpdrflafaalplqdpdaateelqrcvndl
    gfvgalvngfsqegdgqtplyydlpqyrpfwgevekldvpfylhprnplpqdsriydghp
    wllgptwafaqetavhalrlmasglfdehprlniilghmgeglpymmwridhrnawvklp
    prypakrrfmdyfnenfhittsgnfrtqtlidaileigadrilfstdwpfenidhasdwf
    natsiaeadrvkigrtnarrlfkld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2dvuB (B:)
    mqgkvaleehfaipetlqdsagfvpgdywkelqhrlldiqdtrlklmdahgietmilsln
    apavqaipdrrkaieiarrandvlaeecakrpdrflafaalplqdpdaateelqrcvndl
    gfvgalvngfsqegdgqtplyydlpqyrpfwgevekldvpfylhprnplpqdsriydghp
    wllgptwafaqetavhalrlmasglfdehprlniilghmgeglpymmwridhrnawvklp
    prypakrrfmdyfnenfhittsgnfrtqtlidaileigadrilfstdwpfenidhasdwf
    natsiaeadrvkigrtnarrlfkldga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dvuB (B:)
    mqgkvaleehfaipetlqdsagfvpgdywkelqhrlldiqdtrlklmdahgietmilsln
    apavqaipdrrkaieiarrandvlaeecakrpdrflafaalplqdpdaateelqrcvndl
    gfvgalvngfsqegdgqtplyydlpqyrpfwgevekldvpfylhprnplpqdsriydghp
    wllgptwafaqetavhalrlmasglfdehprlniilghmgeglpymmwridhrnawvklp
    prypakrrfmdyfnenfhittsgnfrtqtlidaileigadrilfstdwpfenidhasdwf
    natsiaeadrvkigrtnarrlfkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2dvuC (C:)
    mqgkvaleehfaipetlqdsagfvpgdywkelqhrlldiqdtrlklmdahgietmilsln
    apavqaipdrrkaieiarrandvlaeecakrpdrflafaalplqdpdaateelqrcvndl
    gfvgalvngfsqegdgqtplyydlpqyrpfwgevekldvpfylhprnplpqdsriydghp
    wllgptwafaqetavhalrlmasglfdehprlniilghmgeglpymmwridhrnawvklp
    prypakrrfmdyfnenfhittsgnfrtqtlidaileigadrilfstdwpfenidhasdwf
    natsiaeadrvkigrtnarrlfkldga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dvuC (C:)
    mqgkvaleehfaipetlqdsfvpgdywkelqhrlldiqdtrlklmdahgietmilslnap
    avqaipdrrkaieiarrandvlaeecakrpdrflafaalplqdpdaateelqrcvndlgf
    vgalvngfsqegdgqtplyydlpqyrpfwgevekldvpfylhprnplpqdsriydghpwl
    lgptwafaqetavhalrlmasglfdehprlniilghmgeglpymmwridhrnawvklppr
    ypakrrfmdyfnenfhittsgnfrtqtlidaileigadrilfstdwpfenidhasdwfna
    tsiaeadrvkigrtnarrlfkldg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2dvuD (D:)
    mqgkvaleehfaipetlqdsagfvpgdywkelqhrlldiqdtrlklmdahgietmilsln
    apavqaipdrrkaieiarrandvlaeecakrpdrflafaalplqdpdaateelqrcvndl
    gfvgalvngfsqegdgqtplyydlpqyrpfwgevekldvpfylhprnplpqdsriydghp
    wllgptwafaqetavhalrlmasglfdehprlniilghmgeglpymmwridhrnawvklp
    prypakrrfmdyfnenfhittsgnfrtqtlidaileigadrilfstdwpfenidhasdwf
    natsiaeadrvkigrtnarrlfkldga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dvuD (D:)
    mqgkvaleehfaipetlqdsvpgdywkelqhrlldiqdtrlklmdahgietmilslnapa
    vqaipdrrkaieiarrandvlaeecakrpdrflafaalplqdpdaateelqrcvndlgfv
    galvngfsqegdgqtplyydlpqyrpfwgevekldvpfylhprnplpqdsriydghpwll
    gptwafaqetavhalrlmasglfdehprlniilghmgeglpymmwridhrnawvklppry
    pakrrfmdyfnenfhittsgnfrtqtlidaileigadrilfstdwpfenidhasdwfnat
    siaeadrvkigrtnarrlfkl