PDB entry 2dvt

View 2dvt on RCSB PDB site
Description: Crystal Structure of 2,6-Dihydroxybenzoate Decarboxylase from Rhizobium
Class: lyase
Keywords: tim barrel, lyase
Deposited on 2006-08-01, released 2006-09-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.18
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermophilic reversible gamma-resorcylate decarboxylase
    Species: Rhizobium sp. [TaxId:267998]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2dvta1
  • Chain 'B':
    Compound: Thermophilic reversible gamma-resorcylate decarboxylase
    Species: Rhizobium sp. [TaxId:267998]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2dvtb_
  • Chain 'C':
    Compound: Thermophilic reversible gamma-resorcylate decarboxylase
    Species: Rhizobium sp. [TaxId:267998]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2dvtc_
  • Chain 'D':
    Compound: Thermophilic reversible gamma-resorcylate decarboxylase
    Species: Rhizobium sp. [TaxId:267998]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2dvtd_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dvtA (A:)
    mqgkvaleehfaipetlqdsagfvpgdywkelqhrlldiqdtrlklmdahgietmilsln
    apavqaipdrrkaieiarrandvlaeecakrpdrflafaalplqdpdaateelqrcvndl
    gfvgalvngfsqegdgqtplyydlpqyrpfwgevekldvpfylhprnplpqdsriydghp
    wllgptwafaqetavhalrlmasglfdehprlniilghmgeglpymmwridhrnawvklp
    prypakrrfmdyfnenfhittsgnfrtqtlidaileigadrilfstdwpfenidhasdwf
    natsiaeadrvkigrtnarrlfkldga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dvtA (A:)
    mqgkvaleehfaipetlqdsagfvpgdywkelqhrlldiqdtrlklmdahgietmilsln
    apavqaipdrrkaieiarrandvlaeecakrpdrflafaalplqdpdaateelqrcvndl
    gfvgalvngfsqegdgqtplyydlpqyrpfwgevekldvpfylhprnplpqdsriydghp
    wllgptwafaqetavhalrlmasglfdehprlniilghmgeglpymmwridhrnawvklp
    prypakrrfmdyfnenfhittsgnfrtqtlidaileigadrilfstdwpfenidhasdwf
    natsiaeadrvkigrtnarrlfkld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2dvtB (B:)
    mqgkvaleehfaipetlqdsagfvpgdywkelqhrlldiqdtrlklmdahgietmilsln
    apavqaipdrrkaieiarrandvlaeecakrpdrflafaalplqdpdaateelqrcvndl
    gfvgalvngfsqegdgqtplyydlpqyrpfwgevekldvpfylhprnplpqdsriydghp
    wllgptwafaqetavhalrlmasglfdehprlniilghmgeglpymmwridhrnawvklp
    prypakrrfmdyfnenfhittsgnfrtqtlidaileigadrilfstdwpfenidhasdwf
    natsiaeadrvkigrtnarrlfkldga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dvtB (B:)
    mqgkvaleehfaipetlqdsagfvpgdywkelqhrlldiqdtrlklmdahgietmilsln
    apavqaipdrrkaieiarrandvlaeecakrpdrflafaalplqdpdaateelqrcvndl
    gfvgalvngfsqegdgqtplyydlpqyrpfwgevekldvpfylhprnplpqdsriydghp
    wllgptwafaqetavhalrlmasglfdehprlniilghmgeglpymmwridhrnawvklp
    prypakrrfmdyfnenfhittsgnfrtqtlidaileigadrilfstdwpfenidhasdwf
    natsiaeadrvkigrtnarrlfkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2dvtC (C:)
    mqgkvaleehfaipetlqdsagfvpgdywkelqhrlldiqdtrlklmdahgietmilsln
    apavqaipdrrkaieiarrandvlaeecakrpdrflafaalplqdpdaateelqrcvndl
    gfvgalvngfsqegdgqtplyydlpqyrpfwgevekldvpfylhprnplpqdsriydghp
    wllgptwafaqetavhalrlmasglfdehprlniilghmgeglpymmwridhrnawvklp
    prypakrrfmdyfnenfhittsgnfrtqtlidaileigadrilfstdwpfenidhasdwf
    natsiaeadrvkigrtnarrlfkldga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dvtC (C:)
    mqgkvaleehfaipetlqdsvpgdywkelqhrlldiqdtrlklmdahgietmilslnapa
    vqaipdrrkaieiarrandvlaeecakrpdrflafaalplqdpdaateelqrcvndlgfv
    galvngfsqegdgqtplyydlpqyrpfwgevekldvpfylhprnplpqdsriydghpwll
    gptwafaqetavhalrlmasglfdehprlniilghmgeglpymmwridhrnawvklppry
    pakrrfmdyfnenfhittsgnfrtqtlidaileigadrilfstdwpfenidhasdwfnat
    siaeadrvkigrtnarrlfkldg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2dvtD (D:)
    mqgkvaleehfaipetlqdsagfvpgdywkelqhrlldiqdtrlklmdahgietmilsln
    apavqaipdrrkaieiarrandvlaeecakrpdrflafaalplqdpdaateelqrcvndl
    gfvgalvngfsqegdgqtplyydlpqyrpfwgevekldvpfylhprnplpqdsriydghp
    wllgptwafaqetavhalrlmasglfdehprlniilghmgeglpymmwridhrnawvklp
    prypakrrfmdyfnenfhittsgnfrtqtlidaileigadrilfstdwpfenidhasdwf
    natsiaeadrvkigrtnarrlfkldga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dvtD (D:)
    mqgkvaleehfaipetlqdsvpgdywkelqhrlldiqdtrlklmdahgietmilslnapa
    vqaipdrrkaieiarrandvlaeecakrpdrflafaalplqdpdaateelqrcvndlgfv
    galvngfsqegdgqtplyydlpqyrpfwgevekldvpfylhprnplpqdsriydghpwll
    gptwafaqetavhalrlmasglfdehprlniilghmgeglpymmwridhrnawvklppry
    pakrrfmdyfnenfhittsgnfrtqtlidaileigadrilfstdwpfenidhasdwfnat
    siaeadrvkigrtnarrlfkl