PDB entry 2dvc

View 2dvc on RCSB PDB site
Description: Structure of the bovine lactoferrin C-lobe complex with sucrose at 3.0 A resolution
Class: metal binding protein
Keywords: c-lobe, lactoferrin, sucrose, complex, METAL BINDING PROTEIN
Deposited on 2006-07-31, released 2006-08-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactotransferrin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24627 (0-344)
      • see sequence_details (223)
      • see sequence_details (266)
    Domains in SCOPe 2.08: d2dvca_
  • Heterogens: FE, CO3, ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dvcA (A:)
    ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt
    agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav
    drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske
    kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv
    teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf
    ndnteclaklggrptyeeylgteyvtaianlkkcstsplleacaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dvcA (A:)
    ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt
    agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav
    drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske
    kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv
    teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf
    ndnteclaklggrptyeeylgteyvtaianlkkcsleacaf