PDB entry 2dva

View 2dva on RCSB PDB site
Description: Crystal structure of peanut lectin GAL-BETA-1,3-GALNAC-ALPHA-O-ME (Methyl-T-antigen) complex
Class: sugar binding protein
Keywords: legume lectin, agglutinin, open quaternary structure, carbohydrate specificity
Deposited on 2006-07-30, released 2006-11-07
The last revision prior to the SCOP 1.73 freeze date was dated 2006-11-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.197
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galactose-binding lectin
    Species: ARACHIS HYPOGAEA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2dvaa1
  • Chain 'B':
    Compound: Galactose-binding lectin
    Species: ARACHIS HYPOGAEA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2dvab1
  • Chain 'C':
    Compound: Galactose-binding lectin
    Species: ARACHIS HYPOGAEA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2dvac1
  • Chain 'D':
    Compound: Galactose-binding lectin
    Species: ARACHIS HYPOGAEA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2dvad1
  • Heterogens: CA, MN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dvaA (A:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitttrrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dvaA (A:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2dvaB (B:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitttrrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dvaB (B:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2dvaC (C:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitttrrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dvaC (C:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2dvaD (D:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitttrrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dvaD (D:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt