PDB entry 2dub

View 2dub on RCSB PDB site
Description: enoyl-coa hydratase complexed with octanoyl-coa
Deposited on 1997-04-28, released 1998-04-29
The last revision prior to the SCOP 1.57 freeze date was dated 1998-04-29, with a file datestamp of 1998-04-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.204
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d2duba_
  • Chain 'B':
    Domains in SCOP 1.57: d2dubb_
  • Chain 'C':
    Domains in SCOP 1.57: d2dubc_
  • Chain 'D':
    Domains in SCOP 1.57: d2dubd_
  • Chain 'E':
    Domains in SCOP 1.57: d2dube_
  • Chain 'F':
    Domains in SCOP 1.57: d2dubf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dubA (A:)
    nfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgge
    kafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcdi
    iyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvsk
    ifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatdd
    rregmsafvekrkanfkdh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dubA (A:)
    nfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgge
    kafaagadikemqnrtfqdcyshwdhitrikkpviaavngyalgggcelammcdiiyage
    kaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvskifpve
    tlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatddrregm
    safvekrkanfkdh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2dubB (B:)
    nfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgge
    kafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcdi
    iyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvsk
    ifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatdd
    rregmsafvekrkanfkdh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dubB (B:)
    nfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgge
    kafaagadikemqnrtfqdcyshwdhitrikkpviaavngyalgggcelammcdiiyage
    kaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvskifpve
    tlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatddrregm
    safvekrkanfkdh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2dubC (C:)
    nfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgge
    kafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcdi
    iyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvsk
    ifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatdd
    rregmsafvekrkanfkdh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dubC (C:)
    nfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgge
    kafaagadikemqnrtfqdcyshwdhitrikkpviaavngyalgggcelammcdiiyage
    kaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvskifpve
    tlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatddrregm
    safvekrkanfkdh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2dubD (D:)
    anfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgg
    ekafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcd
    iiyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvs
    kifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatd
    drregmsafvekrkanfkdh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dubD (D:)
    anfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgg
    ekafaagadikemqnrtfqdcysgkhwdhitrikkpviaavngyalgggcelammcdiiy
    agekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvskif
    pvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatddrr
    egmsafvekrkanfkdh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2dubE (E:)
    anfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgg
    ekafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcd
    iiyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvs
    kifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatd
    drregmsafvekrkanfkdh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dubE (E:)
    anfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgg
    ekafaagadikemqnrtfqdcyshwdhitrikkpviaavngyalgggcelammcdiiyag
    ekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvskifpv
    etlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatddrreg
    msafvekrkanfkdh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2dubF (F:)
    anfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgg
    ekafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcd
    iiyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvs
    kifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatd
    drregmsafvekrkanfkdh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dubF (F:)
    anfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgg
    ekafaagadikemqnrtfqdcyshwdhitrikkpviaavngyalgggcelammcdiiyag
    ekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvskifpv
    etlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatddrreg
    msafvekrkanfkdh