PDB entry 2du2

View 2du2 on RCSB PDB site
Description: Crystal Structure Analysis of the L-Lactate Oxidase
Class: oxidoreductase
Keywords: tim barrel, fmn, oxidoreductase
Deposited on 2006-07-19, released 2006-12-05
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.162
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lactate oxidase
    Species: Aerococcus viridans [TaxId:1377]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2du2a_
  • Chain 'B':
    Compound: Lactate oxidase
    Species: Aerococcus viridans [TaxId:1377]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2du2b_
  • Chain 'C':
    Compound: Lactate oxidase
    Species: Aerococcus viridans [TaxId:1377]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2du2c_
  • Chain 'D':
    Compound: Lactate oxidase
    Species: Aerococcus viridans [TaxId:1377]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2du2d_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2du2A (A:)
    mnnndieynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkh
    kllyprlaqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtims
    isaysgatfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgn
    rdrdvknkfvypfgmpivqrylrgtaegmslnniygaskqkisprdieeiaghsglpvfv
    kgiqhpedadmaikrgasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvr
    rgehvakalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedl
    kgldlfdnpygyey
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2du2B (B:)
    mnnndieynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkh
    kllyprlaqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtims
    isaysgatfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgn
    rdrdvknkfvypfgmpivqrylrgtaegmslnniygaskqkisprdieeiaghsglpvfv
    kgiqhpedadmaikrgasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvr
    rgehvakalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedl
    kgldlfdnpygyey
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2du2C (C:)
    mnnndieynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkh
    kllyprlaqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtims
    isaysgatfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgn
    rdrdvknkfvypfgmpivqrylrgtaegmslnniygaskqkisprdieeiaghsglpvfv
    kgiqhpedadmaikrgasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvr
    rgehvakalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedl
    kgldlfdnpygyey
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2du2D (D:)
    mnnndieynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkh
    kllyprlaqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtims
    isaysgatfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgn
    rdrdvknkfvypfgmpivqrylrgtaegmslnniygaskqkisprdieeiaghsglpvfv
    kgiqhpedadmaikrgasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvr
    rgehvakalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedl
    kgldlfdnpygyey