PDB entry 2du1

View 2du1 on RCSB PDB site
Description: Crystal Structure of basic winged bean lectin in complex with Methyl-alpha-N-acetyl-D galactosamine
Class: sugar binding protein
Keywords: legume lectin, glycosylated protein, agglutinin
Deposited on 2006-07-19, released 2006-11-07
The last revision prior to the SCOP 1.73 freeze date was dated 2006-11-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.194
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Basic agglutinin
    Species: Psophocarpus tetragonolobus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2du1a1
  • Chain 'B':
    Compound: Basic agglutinin
    Species: Psophocarpus tetragonolobus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2du1b1
  • Chain 'C':
    Compound: Basic agglutinin
    Species: Psophocarpus tetragonolobus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2du1c1
  • Chain 'D':
    Compound: Basic agglutinin
    Species: Psophocarpus tetragonolobus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2du1d1
  • Heterogens: MGC, NAG, CA, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2du1A (A:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpgtne
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >2du1A (A:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2du1B (B:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpgtne
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >2du1B (B:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2du1C (C:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpgtne
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >2du1C (C:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2du1D (D:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpgtne
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >2du1D (D:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg