PDB entry 2du0

View 2du0 on RCSB PDB site
Description: Crystal structure of basic winged bean lectin in complex with Alpha-D-galactose
Class: sugar binding protein
Keywords: legume lectin, glycosylated protein, agglutinin, sugar binding protein
Deposited on 2006-07-19, released 2006-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.194
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Basic agglutinin
    Species: Psophocarpus tetragonolobus [TaxId:3891]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2du0a_
  • Chain 'B':
    Compound: Basic agglutinin
    Species: Psophocarpus tetragonolobus [TaxId:3891]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2du0b_
  • Chain 'C':
    Compound: Basic agglutinin
    Species: Psophocarpus tetragonolobus [TaxId:3891]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2du0c_
  • Chain 'D':
    Compound: Basic agglutinin
    Species: Psophocarpus tetragonolobus [TaxId:3891]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2du0d_
  • Heterogens: GLA, NAG, CA, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2du0A (A:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpgtne
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >2du0A (A:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2du0B (B:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpgtne
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >2du0B (B:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2du0C (C:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpgtne
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >2du0C (C:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2du0D (D:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpgtne
    f
    

    Sequence, based on observed residues (ATOM records): (download)
    >2du0D (D:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg