PDB entry 2dtx

View 2dtx on RCSB PDB site
Description: Structure of Thermoplasma acidophilum aldohexose dehydrogenase (AldT) in complex with D-mannose
Class: oxidoreductase
Keywords: rossmann fold, oxidoreductase
Deposited on 2006-07-18, released 2007-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.198
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucose 1-dehydrogenase related protein
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: Ta0754
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HK51 (2-255)
      • expression tag (1)
    Domains in SCOPe 2.07: d2dtxa1, d2dtxa2
  • Chain 'B':
    Compound: Glucose 1-dehydrogenase related protein
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: Ta0754
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HK51 (2-255)
      • expression tag (1)
    Domains in SCOPe 2.07: d2dtxb1, d2dtxb2
  • Heterogens: BMA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dtxA (A:)
    mgfsdlrdkvvivtgasmgigraiaerfvdegskvidlsihdpgeakydhiecdvtnpdq
    vkasidhifkeygsisvlvnnagiesygkiesmsmgewrriidvnlfgyyyaskfaipym
    irsrdpsivnissvqasiitknasayvtskhavigltksialdyapllrcnavcpatidt
    plvrkaaelevgsdpmriekkisewghehpmqrigkpqevasavaflasreasfitgtcl
    yvdgglsirapistpelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dtxA (A:)
    gfsdlrdkvvivtgasmgigraiaerfvdegskvidlsihdpgeakydhiecdvtnpdqv
    kasidhifkeygsisvlvnnagiesygkiesmsmgewrriidvnlfgyyyaskfaipymi
    rsrdpsivnissvqasiitknasayvtskhavigltksialdyapllrcnavcpatidtp
    lvrkaaelevgsdpmriekkisewghehpmqrigkpqevasavaflasreasfitgtcly
    vdgglsirapistpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2dtxB (B:)
    mgfsdlrdkvvivtgasmgigraiaerfvdegskvidlsihdpgeakydhiecdvtnpdq
    vkasidhifkeygsisvlvnnagiesygkiesmsmgewrriidvnlfgyyyaskfaipym
    irsrdpsivnissvqasiitknasayvtskhavigltksialdyapllrcnavcpatidt
    plvrkaaelevgsdpmriekkisewghehpmqrigkpqevasavaflasreasfitgtcl
    yvdgglsirapistpelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dtxB (B:)
    gfsdlrdkvvivtgasmgigraiaerfvdegskvidlsihdpgeakydhiecdvtnpdqv
    kasidhifkeygsisvlvnnagiesygkiesmsmgewrriidvnlfgyyyaskfaipymi
    rsrdpsivnissvqasiitknasayvtskhavigltksialdyapllrcnavcpatidtp
    lvrkaaelevgsdpmriekkisewghehpmqrigkpqevasavaflasreasfitgtcly
    vdgglsirapistpe