PDB entry 2dto

View 2dto on RCSB PDB site
Description: Crystal Structure Of Biotin Protein Ligase From Pyrococcus Horikoshii OT3 Complexed with ATP and Biotin
Class: ligase
Keywords: Biotin Biosynthesis, Dimer, X-ray Diffraction, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2006-07-13, released 2007-01-13
The last revision prior to the SCOP 1.73 freeze date was dated 2007-01-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.192
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] ligase
    Species: Pyrococcus horikoshii
    Gene: birA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57883 (0-234)
      • modified residue (0)
      • modified residue (43)
      • modified residue (142)
      • modified residue (175)
      • modified residue (185)
    Domains in SCOP 1.73: d2dtoa1, d2dtoa2
  • Chain 'B':
    Compound: 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] ligase
    Species: Pyrococcus horikoshii
    Gene: birA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57883 (0-234)
      • modified residue (0)
      • modified residue (43)
      • modified residue (142)
      • modified residue (175)
      • modified residue (185)
    Domains in SCOP 1.73: d2dtob1, d2dtob2
  • Heterogens: ATP, BTN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2dtoA (A:)
mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk
gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
lvrdnmilgvrvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2dtoB (B:)
mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk
gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
lvrdnmilgvrvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl