PDB entry 2dti

View 2dti on RCSB PDB site
Description: Crystal Structure Of Biotin Protein Ligase From Pyrococcus Horikoshii OT3 in Complex with Biotinyl-5'-AMP, Pyrophosphate and Mn(2+)
Class: ligase
Keywords: Biotin Biosynthesis, Dimer, X-ray Diffraction, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2006-07-12, released 2007-01-12
The last revision prior to the SCOP 1.75 freeze date was dated 2007-01-12, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.234
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 235aa long hypothetical biotin-[acetyl-CoA-carboxylase] ligase
    Species: Pyrococcus horikoshii
    Gene: birA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2dtia1, d2dtia2
  • Chain 'B':
    Compound: 235aa long hypothetical biotin-[acetyl-CoA-carboxylase] ligase
    Species: Pyrococcus horikoshii
    Gene: birA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2dtib1, d2dtib2
  • Heterogens: MN, BT5, POP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2dtiA (A:)
mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk
gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
lvrdnmilgvrvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2dtiB (B:)
mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk
gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
lvrdnmilgvrvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl