PDB entry 2dth

View 2dth on RCSB PDB site
Description: The Crystal Structure of the Orthorhombic Form of Biotin Protein Ligase From Pyrococcus Horikoshii OT3 in Complex with Biotin and ADP
Class: ligase
Keywords: Biotin Biosynthesis, Dimer, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIGASE
Deposited on 2006-07-12, released 2007-01-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.24
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] ligase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: birA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2dtha1, d2dtha2
  • Chain 'B':
    Compound: 235aa long hypothetical biotin--[acetyl-CoA-carboxylase] ligase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: birA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2dthb1, d2dthb2
  • Heterogens: ADP, BTN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2dthA (A:)
mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk
gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
lvrdnmilgvrvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2dthB (B:)
mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk
gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
lvrdnmilgvrvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl