PDB entry 2dtd

View 2dtd on RCSB PDB site
Description: Structure of Thermoplasma acidophilum aldohexose dehydrogenase (AldT) in ligand-free form
Class: oxidoreductase
Keywords: Rossmann fold, OXIDOREDUCTASE
Deposited on 2006-07-12, released 2007-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.189
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucose 1-dehydrogenase related protein
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: Ta0754
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HK51 (2-255)
      • cloning artifact (1)
    Domains in SCOPe 2.07: d2dtda1, d2dtda2
  • Chain 'B':
    Compound: Glucose 1-dehydrogenase related protein
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: Ta0754
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HK51 (2-255)
      • cloning artifact (1)
    Domains in SCOPe 2.07: d2dtdb1, d2dtdb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dtdA (A:)
    mgfsdlrdkvvivtgasmgigraiaerfvdegskvidlsihdpgeakydhiecdvtnpdq
    vkasidhifkeygsisvlvnnagiesygkiesmsmgewrriidvnlfgyyyaskfaipym
    irsrdpsivnissvqasiitknasayvtskhavigltksialdyapllrcnavcpatidt
    plvrkaaelevgsdpmriekkisewghehpmqrigkpqevasavaflasreasfitgtcl
    yvdgglsirapistpelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dtdA (A:)
    gfsdlrdkvvivtgasmgigraiaerfvdegskvidlsihdpgeakydhiecdvtnpdqv
    kasidhifkeygsisvlvnnagiesygkiesmsmgewrriidvnlfgyyyaskfaipymi
    rsrdpsivnissvqasiitknasayvtskhavigltksialdyapllrcnavcpatidtp
    lvrkaaelevgsdpmriekkisewghehpmqrigkpqevasavaflasreasfitgtcly
    vdgglsirapistpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2dtdB (B:)
    mgfsdlrdkvvivtgasmgigraiaerfvdegskvidlsihdpgeakydhiecdvtnpdq
    vkasidhifkeygsisvlvnnagiesygkiesmsmgewrriidvnlfgyyyaskfaipym
    irsrdpsivnissvqasiitknasayvtskhavigltksialdyapllrcnavcpatidt
    plvrkaaelevgsdpmriekkisewghehpmqrigkpqevasavaflasreasfitgtcl
    yvdgglsirapistpelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dtdB (B:)
    gfsdlrdkvvivtgasmgigraiaerfvdegskvidlsihdpgeakydhiecdvtnpdqv
    kasidhifkeygsisvlvnnagiesygkiesmsmgewrriidvnlfgyyyaskfaipymi
    rsrdpsivnissvqasiitknasayvtskhavigltksialdyapllrcnavcpatidtp
    lvrkaaelevgsdpmriekkisewghehpmqrigkpqevasavaflasreasfitgtcly
    vdgglsirapistpe