PDB entry 2dt7

View 2dt7 on RCSB PDB site
Description: Solution structure of the second SURP domain of human splicing factor SF3a120 in complex with a fragment of human splicing factor SF3a60
Class: RNA binding protein
Keywords: NMR, structure genomics, SF3a120, SF3a60, SURP domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2006-07-11, released 2006-12-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Splicing factor 3A subunit 3
    Species: Homo sapiens [TaxId:9606]
    Gene: SF3a60, SF3a3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12874 (1-37)
      • cloning artifact (0)
  • Chain 'B':
    Compound: Splicing factor 3 subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SF3a120/SF3a1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15459 (1-84)
      • cloning artifact (0)
    Domains in SCOPe 2.01: d2dt7b1

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dt7B (B:)
    gaqviqetivpkepppefefiadppsisafdldvvkltaqfvarngrqfltqlmqkeqrn
    yqfdflrpqhslfnyftklveqytk