PDB entry 2dt6

View 2dt6 on RCSB PDB site
Description: Solution structure of the first SURP domain of human splicing factor SF3a120
Class: RNA binding protein
Keywords: NMR, structure genomics, SF3a120, SURP domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2006-07-11, released 2006-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Splicing factor 3 subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SF3a120, SF3a1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15459 (1-63)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d2dt6a1, d2dt6a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dt6A (A:)
    gevrnivdktasfvarngpefearirqneinnpkfnflnpndpyhayyrhkvsefkegka
    qeps