PDB entry 2dt5

View 2dt5 on RCSB PDB site
Description: Crystal Structure of TTHA1657 (AT-rich DNA-binding protein) from Thermus thermophilus HB8
Class: DNA binding protein
Keywords: REX, NADH, NAD, ROSSMANN FOLD, REDOX SENSING, WINGED HELIX, THERMUS THEMOPHILUS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, DNA BINDING PROTEIN
Deposited on 2006-07-11, released 2007-01-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: 0.195
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AT-rich DNA-binding protein
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA1657
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SHS3 (Start-210)
      • engineered (35)
    Domains in SCOPe 2.07: d2dt5a1, d2dt5a2
  • Chain 'B':
    Compound: AT-rich DNA-binding protein
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA1657
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SHS3 (0-210)
      • engineered (35)
    Domains in SCOPe 2.07: d2dt5b1, d2dt5b2
  • Heterogens: SO4, CL, NAD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dt5A (A:)
    mkvpeaaisrlitylrileeleaqgvhrtsseqlgglaqvtafqvrkdlsyfgsygtrgv
    gytvpvlkrelrhilglnrkwglcivgmgrlgsaladypgfgesfelrgffdvdpekvgr
    pvrggviehvdllpqrvpgrieialltvpreaaqkaadllvaagikgilnfapvvlevpk
    evavenvdflagltrlsfailnpkwreemmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dt5A (A:)
    kvpeaaisrlitylrileeleaqgvhrtsseqlgglaqvtafqvrkdlsyfgsygtrgvg
    ytvpvlkrelrhilglnrkwglcivgmgrlgsaladypgfgesfelrgffdvdpekvgrp
    vrggviehvdllpqrvpgrieialltvpreaaqkaadllvaagikgilnfapvvlevpke
    vavenvdflagltrlsfailnpkwreemmg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dt5B (B:)
    mkvpeaaisrlitylrileeleaqgvhrtsseqlgglaqvtafqvrkdlsyfgsygtrgv
    gytvpvlkrelrhilglnrkwglcivgmgrlgsaladypgfgesfelrgffdvdpekvgr
    pvrggviehvdllpqrvpgrieialltvpreaaqkaadllvaagikgilnfapvvlevpk
    evavenvdflagltrlsfailnpkwreemmg