PDB entry 2dsx

View 2dsx on RCSB PDB site
Description: Crystal structure of rubredoxin from Desulfovibrio gigas to ultra-high 0.68 A resolution
Class: electron transport
Keywords: rubredoxin, desulfovibrio gigas, redox, ELECTRON TRANSPORT
Deposited on 2006-07-07, released 2006-10-10
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.68 Å
R-factor: 0.103
AEROSPACI score: 1.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Desulfovibrio gigas [TaxId:879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2dsxa_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dsxA (A:)
    mdiyvctvcgyeydpakgdpdsgikpgtkfedlpddwacpvcgaskdafekq