PDB entry 2dsq

View 2dsq on RCSB PDB site
Description: Structural Basis for the Inhibition of Insulin-like Growth Factors by IGF Binding Proteins
Class: protein binding/hormone/growth factor
Keywords: IGF, IGFBP, Insulin
Deposited on 2006-07-05, released 2006-08-22
The last revision prior to the SCOP 1.73 freeze date was dated 2006-09-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.292
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Insulin-like growth factor-binding protein 4
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Insulin-like growth factor-binding protein 4
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Insulin-like growth factor IB
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2dsqc1
  • Chain 'G':
    Compound: Insulin-like growth factor-binding protein 1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Insulin-like growth factor-binding protein 1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Insulin-like growth factor IB
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2dsqi1

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2dsqC (C:)
    gpetlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemy
    caplkpaksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dsqC (C:)
    petlcgaelvdalqfvcgdrgfyfnkpttgivdeccfrscdlrrlemycap
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2dsqI (I:)
    gpetlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemy
    caplkpaksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dsqI (I:)
    petlcgaelvdalqfvcgdrgfyfnkgivdeccfrscdlrrlemycapl