PDB entry 2dsp

View 2dsp on RCSB PDB site
Description: Structural Basis for the Inhibition of Insulin-like Growth Factors by IGF Binding Proteins
Class: protein binding/hormone/growth factor
Keywords: IGF, IGFBP, Insulin, PROTEIN BINDING/HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2006-07-05, released 2006-08-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.223
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Insulin-like growth factor-binding protein 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2dspb1
  • Chain 'I':
    Compound: Insulin-like growth factor IB
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2dspi_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2dspB (B:)
    deaihcppcseeklarcrppvgceelvrepgcgccatcalglgmpcgvytprcgsglrcy
    pprgvekplhtlmhgqgvcmelaeieaiqesl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dspB (B:)
    deaihcppcseeklarcrppvgceelvrepgcgccatcalglgmpcgvytprcgsglrcy
    ppgvekplhtlmhgqgvcmelaeieaiqesl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2dspI (I:)
    gpetlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemy
    caplkpaksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dspI (I:)
    petlcgaelvdalqfvcgdrgfyfnkptqtgivdeccfrscdlrrlemycaplkpak